PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Ciclev10004989m
Common NameCICLE_v10004989mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
Family G2-like
Protein Properties Length: 439aa    MW: 49501.1 Da    PI: 9.1288
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Ciclev10004989mgenomeICGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like91.95.4e-29200253155
          G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                      kpr++W+ eLH++Fv+av++L G++kA+Pk+ilelm+v+gLt+e+v+SHLQkYRl
  Ciclev10004989m 200 KPRVVWSVELHQQFVSAVNHL-GIDKAVPKKILELMNVPGLTRENVASHLQKYRL 253
                      79*******************.********************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:3.40.50.23003.8E-1196162No hitNo description
SuperFamilySSF521722.85E-797144IPR011006CheY-like superfamily
SuperFamilySSF466896.63E-20197257IPR009057Homeodomain-like
PROSITE profilePS5129410.813197256IPR017930Myb domain
Gene3DG3DSA:1.10.10.607.9E-30199257IPR009057Homeodomain-like
TIGRFAMsTIGR015572.5E-25200253IPR006447Myb domain, plants
PfamPF002498.1E-8202252IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000160Biological Processphosphorelay signal transduction system
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0016021Cellular Componentintegral component of membrane
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 439 aa     Download sequence    Send to blast
MMILLVLGSW KRCLGHVFMK LQNAIEQRLL WICFERTRMG TTLLSVRFIC QIWMDSNSLS  60
RSGWRWTCRL SVSSLLNDSL LRTLILLIES DLCNCTVMSA DDSKQVVMKG VTHGACDYLI  120
KPVRIEALKN IWQHVVRKRK NEWKDLEQSG SVEERDRQPK PSEEADYSSS ANEGNWRTSK  180
RRKDEEEEME ERDDTSTLKK PRVVWSVELH QQFVSAVNHL GIDKAVPKKI LELMNVPGLT  240
RENVASHLQK YRLYLTRLSG VSPHQGNSFI SSHSQEPPYG SLSSLSGLDF QTLAATGQIP  300
AQSLATLQAA GLARSAAKPG LPMPLVDQRN IFSFDNQKLR FGEGQPQHMS SGKQMNLLHG  360
IPTTMDSKQL LNLHHSAQSL RSLSMQASAH GNPSGQSSHL LMQMAQPLFK LLVLCLIISF  420
LCSLYIFFSH PFGVFYCM*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A3e-22199259464ARR10-B
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006419451.10.0hypothetical protein CICLE_v10004989mg
SwissprotQ9ZWJ91e-118ARR2_ARATH; Two-component response regulator ARR2
TrEMBLV4S7330.0V4S733_9R
STRINGPOPTR_0010s00320.11e-167(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM24032773
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G16110.11e-106response regulator 2